Radhe Krishna Shayari HD Wallpaper Application icon

Radhe Krishna Shayari HD Wallpaper CA

10.4 MB / 5K+ Downloads / Rating 3.9 - 11 reviews


See previous versions

Radhe Krishna Shayari HD Wallpaper, developed and published by Chalisa Sangrah, has released its latest version, CA, on 2020-08-21. This app falls under the Social category on the Google Play Store and has achieved over 5000 installs. It currently holds an overall rating of 3.9, based on 11 reviews.

Radhe Krishna Shayari HD Wallpaper APK available on this page is compatible with all Android devices that meet the required specifications (Android 4.0+). It can also be installed on PC and Mac using an Android emulator such as Bluestacks, LDPlayer, and others.

Read More

App Screenshot

App Screenshot

App Details

Package name: com.chalisaapps.radhekrishanwallpapershayari

Updated: 4 years ago

Developer Name: Chalisa Sangrah

Category: Social

New features: Show more

App Permissions: Show more

Installation Instructions

This article outlines two straightforward methods for installing Radhe Krishna Shayari HD Wallpaper on PC Windows and Mac.

Using BlueStacks

  1. Download the APK/XAPK file from this page.
  2. Install BlueStacks by visiting http://bluestacks.com.
  3. Open the APK/XAPK file by double-clicking it. This action will launch BlueStacks and begin the application's installation. If the APK file does not automatically open with BlueStacks, right-click on it and select 'Open with...', then navigate to BlueStacks. Alternatively, you can drag-and-drop the APK file onto the BlueStacks home screen.
  4. Wait a few seconds for the installation to complete. Once done, the installed app will appear on the BlueStacks home screen. Click its icon to start using the application.

Using LDPlayer

  1. Download and install LDPlayer from https://www.ldplayer.net.
  2. Drag the APK/XAPK file directly into LDPlayer.

If you have any questions, please don't hesitate to contact us.

App Rating

3.9
Total 11 reviews

Reviews

5 ★, on 2020-08-30
This app was very beautiful Bit what have NICE APP &&&:::I have full stars wow mere taraf se Ise full stars

5 ★, on 2020-07-17
Nice verry qt status Says ashaamit lovely friend .. Jai shree krishna

4 ★, on 2020-02-21
Shandar aap

5 ★, on 2020-08-11
Nice people

4 ★, on 2020-08-08
Good

Previous Versions

Radhe Krishna Shayari HD Wallpaper CA
2020-08-21 / 10.4 MB / Android 4.0+

About this app

Radhe Krishna Shayari HD Wallpaper || राधे कृष्णा -हिंदी शायरी
राधा-कृष्ण के प्रेम को पूरी दुनिया जानती हैं राधा-कृष्ण की प्रेम कहानी अपने आप में प्रेम की परिभाषा हैं हमने इस एप्प में राधा कृष्णा के प्रेम को दिखाया है। राधे कृष्णा हिंदी शायरी में आपको मिलेंगी राधा कृष्ण की फोटोज पर सूंदर शायरी। आप इन शायरी को आसानी शेयर भी कर सकतें हैं।

- Silent Features of Radhe Krishna Shayari HD Wallpaper app.
☀️ Share: Share your status with your friends and family members via Whatssup, Email, SMS and other available sharing options on your device.
☀️ Professionally designed, user-friendly and intuitive interface.
☀️ Simple app. No internet connection needed!


◙Disclaimer:
1. This app is a self-contained offline app with a part of the contents from public domain.
2. The purpose of app is to provide entertainment/general information to user. All the images and text contained in the app are collected from different internet sources. All the images are readily available in various places on the internet and are believed to be in the public domain. However, we do not claim ownership/copyright of material/media used in the app. We acknowledge that the respective copyright owners of the contents own the rights. If you own the right to any content in the app, please write to us at chalisaapps@gmail.com with the copyright details of the original source. No infringement intended.

New features

- Radhey Krishna Love Wallpapers.

App Permissions

Allows applications to open network sockets.
Allows applications to access information about networks.
Allows an application to write to external storage.
Allows using PowerManager WakeLocks to keep processor from sleeping or screen from dimming.
Allows an application to read from external storage.