Star Sports -Hotstar live Cricket Streaming Guide Application icon

Star Sports -Hotstar live Cricket Streaming Guide 1.0

6.7 MB / 5+ Downloads / Rating 5.0 - 1 reviews


See previous versions

Star Sports -Hotstar live Cricket Streaming Guide, developed and published by VIVEK DHIMAN, has released its latest version, 1.0, on 2021-04-10. This app falls under the Sports category on the Google Play Store and has achieved over 500 installs. It currently holds an overall rating of 5.0, based on 1 reviews.

Star Sports -Hotstar live Cricket Streaming Guide APK available on this page is compatible with all Android devices that meet the required specifications (Android 4.2+). It can also be installed on PC and Mac using an Android emulator such as Bluestacks, LDPlayer, and others.

Read More

App Screenshot

App Screenshot

App Details

Package name: com.starsportsappfreenewliveapp.watchcricket_live_hotstar

Updated: 4 years ago

Developer Name: VIVEK DHIMAN

Category: Sports

App Permissions: Show more

Installation Instructions

This article outlines two straightforward methods for installing Star Sports -Hotstar live Cricket Streaming Guide on PC Windows and Mac.

Using BlueStacks

  1. Download the APK/XAPK file from this page.
  2. Install BlueStacks by visiting http://bluestacks.com.
  3. Open the APK/XAPK file by double-clicking it. This action will launch BlueStacks and begin the application's installation. If the APK file does not automatically open with BlueStacks, right-click on it and select 'Open with...', then navigate to BlueStacks. Alternatively, you can drag-and-drop the APK file onto the BlueStacks home screen.
  4. Wait a few seconds for the installation to complete. Once done, the installed app will appear on the BlueStacks home screen. Click its icon to start using the application.

Using LDPlayer

  1. Download and install LDPlayer from https://www.ldplayer.net.
  2. Drag the APK/XAPK file directly into LDPlayer.

If you have any questions, please don't hesitate to contact us.

Previous Versions

Star Sports -Hotstar live Cricket Streaming Guide 1.0
2021-04-10 / 6.7 MB / Android 4.2+

About this app

It is a android app which provides all kind of sports and local tv channels as well. Its UI designed considering flexibility of use so that Users are easily connect to this app and can watch their favorite games in one apps. Users need just a android phone with the connection of internet. No need to pay any charges for using this app. In this app uses both real player and web view player and joy is that users are justify their taste use two player.


Features of this app:

Smooth UI;

Almost Every event cover timely;

Users are informed before every matches through notification;

Buffer less stream.

Guide For Watch the latest TV serials, movies, LIVE sports & stream LIVE Republic TV News Channel on your Android device for free. Tips Hotstar FREE HD TV is a live streaming app that lets you watch your favorite shows, jio movies, sports & live republic TV news on-the-go. Watch full episodes of your favorite shows; Hindi, English, Tamil, Kannada, Malayalam, Marathi, Telugu and Bengali in addition to live cricket, republic tv, other sports. TV gives live scores and the latest updating free streaming of videos and video highlights.

Tips Hotstar hd TV shows list also broadcasts regional channels that feature :
1. Malayalam TV shows2. Marathi TV shows. Tamil TV shows4. Telugu TV shows5. Bengali TV shows and much more.
Tamil TV: Captain TV,Jaya TV,Kalaignar TV,Makkal TV,Mega
If you follow this guide you will get all kind of videos Tips.


We are not using any others content, we are using only those which are available in public domain. So if you have any complaint about the content or any part of this app. We urge you please contact us immediately before taking any action. We assure you that review your issue as soon as possible and remove those.

If you Love Sports and Cricket Matches then you are the right place for this.This application provides you the best way to watch live sports and Cricket Matches.If you don't have any source to watch broadcasting of sports then come here and install our application AL-Wahid Sports TV.This application provides you all type of matches streaming like
World Cup Matches
T20 Series
T20 Cricket Matches
ODI Cricket Matches
Live PSL Matches
Champions League Sports
Hockey Matches
Europa League Watch
World Cup Finals
Pakistan Super League.

APPLICATION FEATURES:
- HD streaming
- Single Click Access
- comfortable and easy to use
- eye-catching Sight
- Easy and fastest Watch
- Easy to share with Others
.......................................................................................................................................................
DISCLAIMER NOTICE:
We don't own any content All rights are reserved by their respective owners in this application.We are just providing best way to sports lovers to watch Sports.In case of any problem please contact us by our personal email.
This Application does not afforde any copyright infringement.If you are a copyright owner of any content and you believe that any content on this app has violating your copyrights, please contact us at Perosnal Email.Thank You.

App Permissions

Allows applications to access information about Wi-Fi networks.
Allows an app to access approximate location.
Allows an app to access precise location.
Allows an application to receive the ACTION_BOOT_COMPLETED that is broadcast after the system finishes booting.
Allows applications to connect to paired bluetooth devices.
Allows applications to open network sockets.
Allows applications to access information about networks.