Shakira Wallpapers HD 2019 Application icon

Shakira Wallpapers HD 2019 1.2

11.8 MB / 10+ Downloads / Rating 1.0 - 1 reviews


See previous versions

Shakira Wallpapers HD 2019, developed and published by bmks services, has released its latest version, 1.2, on 2023-01-29. This app falls under the Personalization category on the Google Play Store and has achieved over 1000 installs. It currently holds an overall rating of 1.0, based on 1 reviews.

Shakira Wallpapers HD 2019 APK available on this page is compatible with all Android devices that meet the required specifications (Android 4.0+). It can also be installed on PC and Mac using an Android emulator such as Bluestacks, LDPlayer, and others.

Read More

App Screenshot

App Screenshot

App Details

Package name: com.bmksservices.shakirawallpapershd

Updated: 2 years ago

Developer Name: bmks services

Category: Personalization

App Permissions: Show more

Installation Instructions

This article outlines two straightforward methods for installing Shakira Wallpapers HD 2019 on PC Windows and Mac.

Using BlueStacks

  1. Download the APK/XAPK file from this page.
  2. Install BlueStacks by visiting http://bluestacks.com.
  3. Open the APK/XAPK file by double-clicking it. This action will launch BlueStacks and begin the application's installation. If the APK file does not automatically open with BlueStacks, right-click on it and select 'Open with...', then navigate to BlueStacks. Alternatively, you can drag-and-drop the APK file onto the BlueStacks home screen.
  4. Wait a few seconds for the installation to complete. Once done, the installed app will appear on the BlueStacks home screen. Click its icon to start using the application.

Using LDPlayer

  1. Download and install LDPlayer from https://www.ldplayer.net.
  2. Drag the APK/XAPK file directly into LDPlayer.

If you have any questions, please don't hesitate to contact us.

App Rating

1.0
Total 1 reviews

Previous Versions

Shakira Wallpapers HD 2019 1.2
2023-01-29 / 11.8 MB / Android 4.0+

About this app

Shakira Wallpapers HD 2019 app is to not only setting Shakira photos as wallpapers but also share & save selected favorite image.

Shakira got her fame through singles and albums like Whenever, Wherever, Hips Don't Lie, She Wolf, Sale el Sol, Waka Waka (This Time for Africa). Shakira is widely regarded as the Queen of Latin Pop

You can express your love towards Shakira with others by sharing this Shakira wallpapers HD!

Shakira Wallpapers HD , We all love Shakira ! Welcome to the world of beautiful Shakira . Here you can find some very beautiful Shakira wallpaper for your phones and tablets.

You can save your favorite Shakira image onto your mobile device and set them as lock screens and wallpapers.

Features of Shakira Wallpapers HD 2019 App:

1.You can set the beautiful Shakira image as wallpaper.

2. You can save your liked Shakira wallpaper to your gallery.

3. You can add Shakira wallpaper to your favorites and can go through the selected wallpapers easily from your favorites than searching in the entire gallery., so it can save your time.

4. You can share your favorite Shakira wallpaper with your friends through watsapp, hike, share it, bluetooth, facebook..etc

5. You can zoom Shakira image.

There are lots of background pictures of pretty Shakira .
This application is made for only one purpose and it is fun or entertainment.

With Shakira Wallpapers HD, Make your phone looks attractive by setting HD Images of Shakira . Amazing Lovely Background, you can choose any photo and set as your home screen in a click away.

Disclaimer
The content provided in this app is available in public domain & Web. We do not upload any images or not showing any modified content. If any image wants to be removed from the App or if any images we linked is unauthorized or violating copyrights., Please send mail to bmpksservices@gmail.com with specific image and We will Remove the image ASAP. Please email us if any images we linked is unauthorized or violating copyrights.

contact email : bmpksservices@gmail.com

App Permissions

Allows applications to set the wallpaper.
Allows applications to set the wallpaper hints.
Allows an application to write to external storage.
Allows applications to open network sockets.
Allows applications to access information about networks.
Allows an application to read from external storage.