Ayyappan Swamy Wallpapers HD Application icon

Ayyappan Swamy Wallpapers HD 1.0

13.1 MB / 5K+ Downloads / Rating 4.3 - 12 reviews


See previous versions

Ayyappan Swamy Wallpapers HD, developed and published by bmks services, has released its latest version, 1.0, on 2020-08-14. This app falls under the Personalization category on the Google Play Store and has achieved over 5000 installs. It currently holds an overall rating of 4.3, based on 12 reviews.

Ayyappan Swamy Wallpapers HD APK available on this page is compatible with all Android devices that meet the required specifications (Android 4.0+). It can also be installed on PC and Mac using an Android emulator such as Bluestacks, LDPlayer, and others.

Read More

App Screenshot

App Screenshot

App Details

Package name: com.bmksservices.ayyappanswamywallpapers

Updated: 4 years ago

Developer Name: bmks services

Category: Personalization

App Permissions: Show more

Installation Instructions

This article outlines two straightforward methods for installing Ayyappan Swamy Wallpapers HD on PC Windows and Mac.

Using BlueStacks

  1. Download the APK/XAPK file from this page.
  2. Install BlueStacks by visiting http://bluestacks.com.
  3. Open the APK/XAPK file by double-clicking it. This action will launch BlueStacks and begin the application's installation. If the APK file does not automatically open with BlueStacks, right-click on it and select 'Open with...', then navigate to BlueStacks. Alternatively, you can drag-and-drop the APK file onto the BlueStacks home screen.
  4. Wait a few seconds for the installation to complete. Once done, the installed app will appear on the BlueStacks home screen. Click its icon to start using the application.

Using LDPlayer

  1. Download and install LDPlayer from https://www.ldplayer.net.
  2. Drag the APK/XAPK file directly into LDPlayer.

If you have any questions, please don't hesitate to contact us.

App Rating

4.3
Total 12 reviews

Reviews

5 ★, on 2019-11-11
Very nice app

5 ★, on 2020-01-01
Super

5 ★, on 2020-01-01
Dinesh

1 ★, on 2020-03-05
Whost

Previous Versions

Ayyappan Swamy Wallpapers HD 1.0
2020-08-14 / 13.1 MB / Android 4.0+

About this app

Lord Ayyappan Swamy Wallpapers HD 2019 app is to not only setting Lord Ayyappan Swamy photos as wallpapers but also share & save selected favorite image.

You can express your love towards Lord Ayyappan Swamy with others by sharing this Lord Ayyappan Swamy wallpapers HD!

Lord Ayyappan Swamy Wallpapers HD , We all love Lord Ayyappan Swamy ! Welcome to the world of beautiful Lord Ayyappan Swamy. Here you can find some very beautiful Lord Ayyappan Swamy wallpaper for your phones and tablets.

You can save your favorite Lord Ayyappan Swamy image onto your mobile device and set them as lock screens and wallpapers.

Features of Lord Ayyappan Swamy Wallpapers HD 2019 App:

1.You can set the beautiful Lord Ayyappan Swamy image as wallpaper.

2. You can save your liked Lord Ayyappan Swamy wallpaper to your gallery.

3. You can add Lord Ayyappan Swamy wallpaper to your favorites and can go through the selected wallpapers easily from your favorites than searching in the entire gallery., so it can save your time.

4. You can share your favorite Lord Ayyappan Swamy wallpaper with your friends through watsapp, hike, share it, bluetooth, facebook..etc

5. You can zoom Lord Ayyappan Swamy image.

There are lots of background pictures of pretty Lord Ayyappan Swamy.
This application is made for only one purpose and it is fun or entertainment.

With Lord Ayyappan Swamy Wallpapers HD, Make your phone looks attractive by setting HD Images of Lord Ayyappan Swamy. Amazing Lovely Background, you can choose any photo and set as your home screen in a click away.

Disclaimer
The content provided in this app is available in public domain & Web. We do not upload any images or not showing any modified content. If any image wants to be removed from the App or if any images we linked is unauthorized or violating copyrights., Please send mail to bmpksservices@gmail.com with specific image and We will Remove the image ASAP. Please email us if any images we linked is unauthorized or violating copyrights.

contact email : bmpksservices@gmail.com

App Permissions

Allows applications to set the wallpaper.
Allows applications to set the wallpaper hints.
Allows an application to write to external storage.
Allows applications to open network sockets.
Allows applications to access information about networks.
Allows an application to read from external storage.